Cart

Buy Quality Peptides online

Fast and Secure Shipping: Experience hassle-free shopping when you buy Quality Peptides online with our fast and secure shipping options. We prioritize your privacy and satisfaction, ensuring your Quality Peptides orders arrive safely and securely at your doorstep.

At Cali BioLab Peptides, we are dedicated to providing a seamless and enjoyable shopping experience. Whether you're a seasoned shopper or a curious newcomer, we invite you to explore the Cali BioLab Peptides . Cheers to a world of premium products and unparalleled service!




  • Showing 1 - 21 of 54 Products
Phosphate Buffered Saline 3ml 10ml
  • - 25%
    No review yet

Phosphate Buffered Saline 3ml 10ml

$3.8 $5
Bacteriostatic Mixing Water -10ml
  • - 25%
    No review yet

Bacteriostatic Mixing Water -10ml

$6 $8
Bacteriostatic Mixing Water 3ml
  • - 20%
    No review yet

Bacteriostatic Mixing Water 3ml

$4 $5
Measuring Syringe 1ml x 1
  • - 50%
    No review yet

Measuring Syringe 1ml x 1

$1 $2
Phosphate Buffered Saline 3ml-10ml
  • - 20%
Acetic Acid
  • - 20%
    No review yet

Acetic Acid

$4 $5
Bacteriostatic Mixing Water 10ml
  • - 25%
    No review yet

Bacteriostatic Mixing Water 10ml

$6 $8
Bacteriostatic Mixing Water 3ml
  • - 20%
    No review yet

Bacteriostatic Mixing Water 3ml

$4 $5
BPC-157 TB-500 Research Bundle
  • - 25%
    No review yet

BPC-157 TB-500 Research Bundle

$39 $52
SLU-PP-332 10mg Peptide
  • - 26%
    No review yet

SLU-PP-332 10mg Peptide

$50 $67
LL-37 5mg Peptide
  • - 26%
    No review yet

LL-37 5mg Peptide

$35 $47
Cagrilintide 5mg Peptide
  • - 26%
    No review yet

Cagrilintide 5mg Peptide

$50 $67
Snap-8 10mg Peptide
  • - 25%
    No review yet

Snap-8 10mg Peptide

$22 $29
SS-31 10mg-50mg Peptide
  • - 26%
    No review yet

SS-31 10mg-50mg Peptide

$35 $47
PT-141 10mg Peptide
  • - 25%
    No review yet

PT-141 10mg Peptide

$21 $28
Thymosin Alpha 1 5mg-10mg Peptide
  • - 25%
    No review yet

Thymosin Alpha 1 5mg-10mg Peptide

$27 $36
Sermorelin 5mg Peptide
  • - 25%
    No review yet

Sermorelin 5mg Peptide

$25 $33
KPV 10mg Peptide
  • - 26%
    No review yet

KPV 10mg Peptide

$40 $54
Kisspeptin-10 10mg Peptide
  • - 26%
    No review yet

Kisspeptin-10 10mg Peptide

$40 $54
DSIP 5mg-15mg Peptide
  • - 23%
    No review yet

DSIP 5mg-15mg Peptide

$14 $18


The Hidden Defender Within: How One Tiny Peptide Is Revolutionizing Lab Studies on Infection, Healing, and Immunity

Picture this: deep inside the human body, a microscopic guardian stands ready to battle invading pathogens, orchestrate wound closure, and even guide new blood vessel formation—all without relying on traditional antibiotics or growth factors. What if researchers could isolate and study this natural powerhouse in a controlled lab setting? Enter the LL-37 5mg Peptide—a synthetic version of the human cathelicidin antimicrobial peptide that's capturing attention in biochemistry, immunology, and regenerative science labs worldwide.

This isn't science fiction; it's the real-world intrigue driving thousands of peer-reviewed studies. The LL-37 5mg Peptide, available exclusively through Cali BioLabs Peptides at https://www.calibiolabpeptides.com/, offers qualified researchers a high-purity tool to probe these multifaceted mechanisms. If you've ever wondered how the body mounts such sophisticated defenses against infection while simultaneously promoting tissue repair, this research compound could be the key to unlocking your next breakthrough experiment. Ready to explore why labs are stocking up on LL-37 5mg Peptide? Let's dive in.

Important Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research applications. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or approved animal model studies. Cali BioLabs Peptides prioritizes full regulatory compliance.

The Story of Dr. Marcus and the Chronic Wound Model That Changed Everything

In a mid-sized biotech lab in Boston, Dr. Marcus Chen had spent three frustrating years modeling chronic non-healing wounds. Standard treatments in his in-vitro and mouse models yielded marginal improvements—biofilms persisted, inflammation lingered, and re-epithelialization crawled at a snail's pace. Funding deadlines loomed, and his grant renewal hung in the balance.

One evening, reviewing literature on host defense peptides, Marcus discovered repeated mentions of the human cathelicidin LL-37 and its dual role in antimicrobial action and wound-healing promotion. Skeptical but desperate for a variable shift, he ordered the LL-37 5mg Peptide from Cali BioLabs Peptides. The vial arrived lyophilized, pristine, with a batch-specific COA showing ≥99% purity confirmed by third-party HPLC/MS.

In his next series of experiments, Marcus applied reconstituted LL-37 5mg Peptide to biofilm-laden keratinocyte cultures and diabetic-mimicking wound models. The results stunned the team: bacterial load dropped dramatically within hours, inflammatory cytokine profiles shifted toward resolution, and scratch assays showed accelerated closure rates—up to 40% faster than controls in some replicates. Angiogenesis markers spiked, with tube formation assays revealing robust endothelial network development.

Marcus's paper, later accepted in a high-impact journal on wound biology, credited the LL-37 5mg Peptide as the pivotal reagent that bridged antimicrobial defense and regenerative signaling. His lab secured renewed funding, and the story spread through research networks. Today, Marcus still keeps a framed photo of that first successful assay plate on his desk—a reminder that sometimes the smallest molecule delivers the biggest shift.

Have you experienced a similar "turning point" reagent in your own research? What compound unexpectedly unlocked progress in your models?

What Exactly Is the LL-37 5mg Peptide?

The LL-37 5mg Peptide is a synthetic recreation of the C-terminal 37-amino-acid fragment of human cathelicidin (hCAP-18/LL-37), one of the few cathelicidins expressed in humans. This amphipathic, α-helical peptide is naturally produced by neutrophils, epithelial cells, keratinocytes, and certain lymphocytes as part of the innate immune response.

In research settings, the LL-37 5mg Peptide arrives as a sterile, white lyophilized powder in 5mg vials—perfect for multiple assays, dose-response curves, or extended protocols without constant reordering. Key specifications include:

  • Purity: ≥99% (third-party verified via HPLC and Mass Spectrometry)
  • Form: Lyophilized for stability during shipping and storage
  • Molecular Weight: ~4.5 kDa
  • Sequence: [LL-37, 37 aa]
  • Storage Recommendation: -20°C long-term; 2-8°C after reconstitution with bacteriostatic water or PBS
  • COA: Batch-specific analytical report included with every order

Unlike many research compounds limited to one function, LL-37 5mg Peptide exhibits remarkable multifunctionality. It directly disrupts microbial membranes via carpet-like or toroidal pore mechanisms, inhibits biofilm formation, modulates immune cell chemotaxis, promotes angiogenesis through pathways like FPRL1/VEGFR2 signaling, and influences wound re-epithelialization by activating EGFR and other receptors.

These properties make the LL-37 5mg Peptide a versatile probe for studying innate immunity, infectious disease models, chronic inflammation, tissue repair, and even autoimmune pathway dysregulation (where dysregulated LL-37 expression has been implicated).

Why Researchers Are Turning to LL-37 5mg Peptide in 2026

The "why" is straightforward yet profound: modern research demands tools that mirror complex biological realities. Antibiotics face rising resistance; chronic wounds affect millions with limited options; and understanding host-pathogen-immune crosstalk requires compounds that act at multiple levels.

The LL-37 5mg Peptide addresses these challenges head-on. In vitro and animal model studies consistently demonstrate its ability to:

  • Exert broad-spectrum antimicrobial effects against Gram-positive, Gram-negative bacteria, fungi, and certain viruses
  • Disrupt established biofilms—a major barrier in chronic infection models
  • Accelerate wound closure by enhancing keratinocyte migration, fibroblast activity, and collagen deposition
  • Stimulate angiogenesis, improving perfusion in ischemia or diabetic models
  • Modulate inflammation: pro-inflammatory at high concentrations to recruit immune cells, anti-inflammatory at physiological levels to resolve responses
  • Influence adaptive immunity by promoting dendritic cell maturation and T-cell responses

Sourcing from Cali BioLabs Peptides adds compelling reasons: USA-based manufacturing in certified facilities, fast domestic shipping (often same/next-day processing), free shipping thresholds, secure checkout, and unwavering research-only compliance. Why risk variable purity or delayed delivery when you can have guaranteed quality?

How to Work with LL-37 5mg Peptide in the Lab

Reconstitution and handling of the LL-37 5mg Peptide are straightforward but require precision to preserve activity.

  1. Preparation: Allow the vial to equilibrate to room temperature to avoid condensation.
  2. Reconstitution: Add 1-2 mL bacteriostatic water, sterile PBS, or culture medium-compatible solvent. Gently swirl—never vortex vigorously to prevent aggregation or loss of helical structure.
  3. Concentration: Common stock solutions range from 1-10 mg/mL; dilute further for working concentrations (typically 0.1-10 μM in cell culture or 1-50 μg/mL in antimicrobial assays).
  4. Storage: Use immediately for short-term experiments or aliquot and freeze at -80°C. Avoid repeated freeze-thaw cycles.
  5. Application Examples:
    • Antimicrobial assays: Add to bacterial cultures (MIC determination, time-kill curves)
    • Wound models: Incorporate into scratch assays, 3D skin equivalents, or ex-vivo human skin explants
    • Angiogenesis: Tube formation on Matrigel with endothelial cells
    • Immunomodulation: Treat monocyte/macrophage or dendritic cell cultures to assess cytokine profiles

Always use sterile technique, appropriate PPE, and dispose according to lab protocols. Detailed handling guides are available on the product page at calibiolabpeptides.com.

Key Advantages of LL-37 5mg Peptide – A Researcher’s Checklist

Here’s a concise list of why the LL-37 5mg Peptide frequently tops wish lists:

  • Broad-spectrum activity against resistant pathogens in lab models
  • Dual antimicrobial + pro-regenerative effects for complex wound/infection studies
  • Biofilm disruption capabilities—critical for chronic disease simulations
  • Angiogenic promotion without exogenous VEGF in many models
  • Immunomodulatory versatility: chemotaxis, cytokine regulation, and adaptive bridge
  • High stability when properly handled; long shelf-life lyophilized
  • 5mg size ideal for pilot studies through full experimental series
  • Third-party COA transparency reducing experimental variability
  • Fast, discreet USA shipping from a trusted research supplier
  • Strict research-only focus aligning with IRB and funding requirements

This combination of potency, multifunctionality, and reliability explains its growing popularity.

Frequently Asked Questions About LL-37 5mg Peptide

Q: What makes LL-37 different from other antimicrobial peptides? A: Its human origin reduces immunogenicity concerns in models, and its dual antimicrobial/regenerative roles set it apart from purely lytic peptides.

Q: Is LL-37 stable in culture media? A: Moderately—serum can reduce half-life due to proteases, so protease inhibitors or serum-free conditions are often used in long incubations.

Q: Can I use LL-37 5mg Peptide for in vivo animal studies? A: Yes, in approved protocols—common routes include topical, subcutaneous, or intraperitoneal, with doses typically 1-100 μg/kg depending on model.

Q: How does LL-37 compare to synthetic analogs or shorter fragments? A: Full-length LL-37 retains the broadest activity; fragments may offer improved stability or reduced cytotoxicity but lose some multifunctional potency.

Q: What if my vial arrives compromised? A: Contact Cali BioLabs Peptides support immediately—replacements are provided for verified issues.

Q: Is LL-37 suitable for studying autoimmune models? A: Yes—elevated LL-37 is implicated in conditions like psoriasis and lupus, making it valuable for pathway dissection.

What Breakthrough Could LL-37 5mg Peptide Enable in Your Lab Next?

As we close this exploration, consider this: With rising antibiotic resistance, persistent chronic wounds, and the quest for better infection-healing balance, what specific question could the LL-37 5mg Peptide help you answer? Perhaps dissecting biofilm-immune evasion, optimizing angiogenic therapies, or modeling innate-adaptive crosstalk?

Share your research ideas or current challenges—the scientific community thrives on these exchanges.

In summary, the LL-37 5mg Peptide from Cali BioLabs Peptides is more than a research reagent—it's a window into one of nature's most elegant defense systems. High purity, reliable supply, and unmatched multifunctionality make it an essential addition for labs pushing boundaries in 2026.

Order your LL-37 5mg Peptide today at Cali BioLab Peptides and elevate your experiments with confidence.

 



Selank 5mg – High-Purity Research Peptide

Selank is a synthetic peptide analogue of the naturally occurring immunomodulatory peptide tuftsin, investigated in preclinical research for its potential anxiolytic, neuroprotective, and cognitive-enhancing effects. Supplied as a lyophilised (freeze-dried) solid to preserve stability, this compound is verified at >99.1% purity (HPLC-tested) and provided with full Certificates of Analysis (COAs).


What is Selank?

Selank is a heptapeptide analogue derived from tuftsin, a natural peptide fragment involved in immune regulation. Research has examined Selank for its ability to modulate neurotransmitter systems, reduce anxiety without sedation, and support cognitive clarity. Unlike consumer supplements, Selank supplied by Bluewell Peptides is strictly intended for laboratory research use only and comes with full COA verification for transparency.


Scientific Identifiers

  • Product Name: Selank 5mg

  • Catalogue Number: BWP-SLK-5

  • CAS Number: 129954-34-3

  • Molecular Formula: C₃₃H₅₇N₁₁O₉

  • Molecular Weight: 751.87 g/mol

  • Form: Lyophilised Solid

  • Purity: >99.1% (HPLC Verified)

  • Storage: Store at −20°C, protected from light

  • Unit Size: 5mg


Usage and Reconstitution

Selank is supplied as a lyophilised solid to ensure long-term stability. For laboratory use, it may be reconstituted with bacteriostatic water or another suitable solvent according to established protocols. For detailed guidance, please refer to our peptide reconstitution page. Check out Selank 10mg Peptide.


Research Applications of Selank

Preclinical and laboratory studies have investigated Selank for potential roles in:

  • Anxiolytic Effects – Studied for its ability to modulate GABAergic and serotonergic pathways, reducing anxiety-like behaviours without sedation.

  • Cognitive Support and Neuroprotection – Explored for its influence on memory, learning, and mental clarity, potentially linked to brain-derived neurotrophic factor (BDNF).

  • Immune Modulation – Research suggests Selank may contribute to immune system regulation, particularly under stress or inflammatory conditions.

References available on request or through our research archive.


Why Order Selank from Bluewell Peptides?

  • 99.1% purity, HPLC-verified

  • COA provided with every batch

  • Secure ordering and fast USA delivery

  • Transparent, research-focused supplier

  • Excellent customer support and trusted reviews



How Adamax 10mg Peptide May Push BDNF Signaling and Neuroplasticity Further Than Ever Before

What if a small but brilliantly modified heptapeptide could take the already impressive cognitive and neuroprotective profile of Semax and amplify it—delivering stronger BDNF upregulation, deeper synaptic plasticity, enhanced neuronal survival, and potentially greater resilience against oxidative and inflammatory stress in research models? This is the exciting frontier researchers are beginning to explore with Adamax 10mg Peptide, a next-generation analog of Semax engineered with N-terminal acetylation and C-terminal adamantane-based stabilization for superior stability, blood-brain barrier penetration, and biological potency.

At Cali BioLab Peptides, Adamax 10mg Peptide is supplied as a sterile, high-purity (≥99%) lyophilized powder in a 10mg research vial—third-party HPLC/MS verified, with batch-specific Certificates of Analysis and fast USA domestic shipping. This research-grade compound provides qualified investigators with a cutting-edge tool to probe advanced nootropic mechanisms, neuroregeneration, stress resilience, and BDNF/TrkB pathway dynamics in controlled in-vitro, ex-vivo, or approved animal model studies.

Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research application. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLab Peptides maintains full regulatory compliance.

The Lab That Saw Cognitive Resilience Redefined: Dr. Sofia’s Chronic Stress Model Breakthrough

In a behavioral neuroscience and neuroplasticity group in Boston, Dr. Sofia Chen was modeling chronic unpredictable mild stress (CUMS) in rats to simulate depression-like states with cognitive impairment. Her animals displayed persistent anxiety (elevated plus maze), anhedonia (sucrose preference test), spatial memory deficits (Morris water maze), reduced hippocampal BDNF/TrkB expression, dendritic atrophy, and impaired LTP (long-term potentiation) in slice electrophysiology.

Standard nootropics and antidepressants offered partial relief but failed to fully restore synaptic plasticity or BDNF signaling under ongoing stress. Sofia had followed emerging reports on Semax analogs and decided to test Adamax 10mg Peptide, sourcing a 10mg vial from Cali BioLab Peptides. The product arrived lyophilized with a COA confirming 99.5% purity.

In her 4-week intervention, Sofia administered intranasal or intraperitoneal Adamax 10mg Peptide (~50–300 μg/kg daily). The outcomes were striking: treated rats showed normalized anxiety behaviors, restored sucrose preference, significantly improved spatial learning/memory, robust hippocampal BDNF/TrkB upregulation (qPCR and Western blot), increased dendritic spine density (Golgi staining), and enhanced LTP magnitude compared to vehicle controls. Notably, these effects appeared more sustained and pronounced than with equivalent Semax dosing in parallel cohorts.

Sofia’s publication in a respected neuropsychopharmacology journal positioned Adamax 10mg Peptide as a superior probe for stress-resilient neuroplasticity and BDNF-driven cognitive recovery. The study attracted new collaborators and funding for follow-on neurodegeneration models. The Adamax 10mg Peptide became a key reagent in her lab’s resilience and synaptic plasticity platform.

What Exactly Is Adamax 10mg Peptide?

Adamax 10mg Peptide is a synthetic heptapeptide derivative of Semax (Met-Glu-His-Phe-Pro-Gly-Pro), further modified with N-terminal acetylation and C-terminal adamantane-based extension to enhance stability, lipophilicity, blood-brain barrier penetration, and duration of action.

Key product specifications:

  • Quantity: 10mg sterile lyophilized powder per vial—ideal for dose-response studies, behavioral paradigms, chronic protocols, or combination experiments
  • Purity: ≥99% (third-party verified by HPLC and Mass Spectrometry)
  • Sequence: Ac-Met-Glu-His-Phe-Pro-Gly-Pro-Ala-Gly-NH₂ (or similar reported variants with adamantane modification)
  • Molecular Weight: ≈900–1000 Da (exact mass depends on final adamantane integration)
  • Form: White, sterile lyophilized powder optimized for reconstitution
  • Storage: -20°C long-term; 2-8°C after reconstitution with bacteriostatic water or PBS
  • COA: Batch-specific analytical report included

In research contexts, Adamax 10mg Peptide is studied primarily for its amplified effects on brain-derived neurotrophic factor (BDNF) expression, TrkB receptor signaling, synaptic plasticity, neuroprotection, and stress resilience—often showing greater potency and duration than parent Semax in comparative models.

How Does Adamax 10mg Peptide Work in Biological Systems?

Adamax 10mg Peptide acts as a potent modulator of neurotrophic and neuroplastic pathways, primarily through:

  • Strong upregulation of BDNF mRNA and protein in hippocampal and cortical regions
  • Enhanced TrkB receptor activation and downstream signaling (PI3K/Akt, MAPK/ERK)
  • Increased dendritic spine density and synaptic strength (LTP facilitation)
  • Neuroprotective effects against oxidative stress, excitotoxicity, and inflammation
  • Modulation of monoamine systems (dopamine, serotonin) under stress
  • Improved blood-brain barrier penetration and extended half-life due to adamantane and acetylation modifications

These actions are concentration-dependent and frequently more pronounced than Semax in head-to-head studies.

Research Applications of Adamax 10mg Peptide

Adamax 10mg Peptide is applied in:

  • Cognitive enhancement and memory consolidation models (Morris water maze, novel object recognition)
  • Chronic stress and depression analogs (CUMS, learned helplessness)
  • Neuroprotection in ischemia, trauma, or neurodegenerative paradigms
  • BDNF/TrkB pathway dissection (qPCR, Western blot, immunohistochemistry)
  • Synaptic plasticity and LTP studies (hippocampal slice electrophysiology)
  • Anxiety and mood regulation under stress (elevated plus maze, forced swim test)

Key endpoints where Adamax 10mg Peptide excels:

  • Increased BDNF/TrkB expression and signaling
  • Enhanced dendritic spine density and synaptic markers
  • Improved cognitive performance under stress
  • Reduced anxiety-like behaviors
  • Neuroprotection against oxidative/inflammatory insult
  • Sustained neuroplasticity benefits vs. shorter-acting analogs

Usage and Reconstitution Guidelines for Adamax 10mg Peptide

  1. Allow vial to reach room temperature.
  2. Add 1–2 mL bacteriostatic water or sterile PBS; gently swirl to dissolve.
  3. Prepare stock solutions (e.g., 5 mg/mL) and dilute for working concentrations (typically 50–500 μg/kg in vivo, often intranasal or IP; μg/mL in vitro).
  4. Aliquot immediately and store at –80 °C; thawed aliquots stable 2–8 °C for days.

Common routes: intranasal (excellent CNS delivery), subcutaneous, intraperitoneal. Use sterile technique.

Frequently Asked Questions About Adamax 10mg Peptide

Q: How does Adamax 10mg Peptide differ from Semax? A: Adamax 10mg Peptide incorporates N-acetylation and adamantane-based C-terminal modification for greater stability, BBB penetration, and potency—often showing stronger and more sustained BDNF/neuroplasticity effects in comparative models.

Q: What dosing ranges are common in preclinical literature? A: In-vivo studies typically use 50–500 μg/kg (intranasal or IP); effects frequently show inverted U-shaped dose-response.

Q: Is Adamax 10mg Peptide suitable for chronic stress or neurodegeneration models? A: Yes—preclinical data indicate robust benefits in stress resilience, BDNF restoration, and neuroprotection.

Q: Stability post-reconstitution? A: Stable for weeks refrigerated when aliquoted; freeze for longer storage.

Q: Can it be combined with other nootropic peptides? A: Yes—often paired with Selank, Semax, or P21 for synergistic cognitive and neuroprotective effects.

Q: How to verify batch quality? A: Match the provided COA on the product page.

What Neuroplasticity or Cognitive Resilience Question Could Adamax 10mg Peptide Help You Answer?

With interest surging in amplified BDNF and synaptic modulators, what specific stress-induced cognitive deficit, BDNF/TrkB dynamic, or neuroregenerative pathway might Adamax 10mg Peptide illuminate in your models? Could it outperform standard nootropics in your chronic stress or neurodegeneration paradigms?

Share your research perspective—the exchange fuels scientific progress.

In summary, Adamax 10mg Peptide from Cali BioLab Peptides is a next-generation Semax analog with enhanced potency and duration for BDNF, neuroplasticity, and resilience research. With exceptional purity, reliable supply, and emerging preclinical promise, it's poised to support your 2026 breakthroughs.

Order your Adamax 10mg Peptide today at Cali BioLab Peptides and push the boundaries of cognitive enhancement and brain repair with confidence.



CJC-1295 No DAC 5mg – High-Purity Research Peptide

CJC-1295 No DAC (also known as MOD GRF 1-29) is a synthetic research peptide widely studied in preclinical and laboratory settings for its role in stimulating growth hormone release through GHRH receptor activation. Supplied in lyophilised (freeze-dried) form to preserve stability, this compound is HPLC-verified at >99% purity and accompanied by full Certificates of Analysis (COAs).


What is CJC-1295 No DAC?

CJC-1295 No DAC is a shorter-acting analogue of growth hormone–releasing hormone (GHRH), designed to support research into pulsatile GH release without extended half-life modification. It has been investigated in models related to endocrine function, metabolism, and cellular recovery. Unlike long-acting DAC variants, CJC-1295 No DAC produces a shorter but more physiologically relevant GH pulse, making it a valuable peptide in certain research contexts.


Scientific Identifiers

  • Product Name: CJC-1295 No DAC 5mg

  • Catalogue Number: BWP-CJC-ND5

  • CAS Number: 863288-34-0

  • Molecular Formula: C152H252N44O42

  • Molecular Weight: 3367.9 g/mol

  • Form: Lyophilised Solid

  • Purity: >99% (HPLC Verified)

  • Storage: Store at −20°C in a dry, dark place

  • Unit Size: 5mg


Usage and Reconstitution

CJC-1295 No DAC is supplied as a lyophilised solid for maximum stability. For research applications, it may be reconstituted with bacteriostatic water or a suitable solvent according to laboratory protocols. Avoid repeated freeze–thaw cycles. For guidance, see our [Reconstitution Guide].


Research Applications of CJC-1295 No DAC

CJC-1295 No DAC has been investigated in preclinical and laboratory studies for its potential influence on:

  • Growth Hormone Secretion Research – Studied for its role in stimulating GH release via GHRH receptor activation.

  • Endocrine Function Studies – Used to study pituitary activity and hormone regulation.

  • Metabolic & Recovery Research – Explored for its effects on protein synthesis, recovery, and cellular metabolism.

References available on request or in our research archive.


Why Order CJC-1295 No DAC from Bluewell Peptides?

  • Verified >99% purity, HPLC-tested

  • COA provided with every batch

  • Secure checkout and fast USA delivery

  • Trusted research-focused supplier

  • Excellent customer support



Unlocking the Secrets of Regeneration: Dive into the World of the BPC-157 TB-500 Research Bundle

Imagine a breakthrough in your lab where damaged tissues mend before your eyes, where cellular repair mechanisms accelerate like never before, and where the boundaries of scientific discovery push further into the unknown. What if a single research tool could hold the key to unraveling these mysteries? Enter the BPC-157 TB-500 Research Bundle – a powerhouse combination that's captivating researchers worldwide. This isn't just another peptide set; it's a gateway to exploring the frontiers of regenerative science, all from the comfort of your controlled laboratory environment. If you're a qualified researcher eager to elevate your studies, buckle up – this bundle might just redefine your next experiment.

The Story of Dr. Elena's Breakthrough Discovery

Let me take you back to a bustling university lab in California, where Dr. Elena Ramirez, a dedicated biochemist with over 15 years in peptide research, was on the verge of giving up on her long-term project. Elena had been investigating tissue repair models for years, but her results were inconsistent – slow progress, unreliable outcomes, and mounting frustration. One late night, scrolling through supplier catalogs, she stumbled upon the BPC-157 TB-500 Research Bundle from Cali BioLab Peptides. Skeptical at first, she decided to order it for a trial run.

What happened next became lab legend. In her in-vitro models, the bundle's synergistic effects lit up her assays like fireworks. Cells that previously showed minimal migration and proliferation now demonstrated enhanced activity, mimicking accelerated repair processes. Elena's data poured in: quantifiable improvements in angiogenesis markers, reduced inflammation signals, and faster matrix remodeling. Her paper, published in a prestigious journal, credited the BPC-157 TB-500 Research Bundle as the catalyst that turned her stalled research into a funded grant. Of course, this was all under strict research protocols – no human applications here. Elena's story isn't unique; it's a testament to how the right tools can spark innovation in the lab. Have you ever had a "eureka" moment like that in your own work?

What Exactly Is the BPC-157 TB-500 Research Bundle?

At its core, the BPC-157 TB-500 Research Bundle is a meticulously curated package designed exclusively for laboratory and scientific research purposes. Offered by Cali BioLab Peptides at https://www.calibiolabpeptides.com/, this bundle combines two highly studied peptides: BPC-157 and TB-500, typically in a blended or paired format for convenience. BPC-157, short for Body Protection Compound-157, is a synthetic pentadecapeptide derived from a protective protein found in gastric juices. It's been the subject of numerous in-vitro and animal model studies focusing on its potential roles in cellular protection and repair mechanisms.

TB-500, on the other hand, is a synthetic version of Thymosin Beta-4, a naturally occurring peptide involved in actin sequestration and cellular motility. When bundled together, these peptides offer researchers a versatile tool for exploring synergistic effects in controlled environments. The BPC-157 TB-500 Research Bundle usually comes lyophilized in sterile vials, with options like 10mg blends (often 5mg of each) or separate vials for customized dosing. Each product is third-party tested for ≥99% purity, accompanied by batch-specific Certificates of Analysis (COAs), ensuring transparency and reliability for your experiments.

Important disclaimer: The BPC-157 TB-500 Research Bundle is strictly for research use only. It is not intended for human consumption, therapeutic applications, or any form of medical treatment. All studies must comply with ethical guidelines and institutional review boards. Cali BioLab Peptides emphasizes that these compounds are for qualified researchers conducting in-vitro or animal-based investigations, helping to advance fields like biochemistry, cell biology, and regenerative science.

In essence, this bundle represents a strategic pairing that allows scientists to probe deeper into how peptides might influence processes such as wound healing models, anti-inflammatory pathways, and tissue regeneration simulations. If you're wondering why this specific combination stands out, it's because preliminary research suggests their complementary actions could amplify outcomes in lab settings – but more on that later.

Why Choose the BPC-157 TB-500 Research Bundle for Your Studies?

The "why" behind the BPC-157 TB-500 Research Bundle boils down to its potential to revolutionize how researchers approach regenerative studies. In a world where scientific progress hinges on reliable tools, this bundle addresses key challenges like inconsistent peptide quality and the need for multi-faceted compounds. Why settle for isolated peptides when a bundle offers synergy? Studies in animal models have indicated that BPC-157 may support gastrointestinal integrity and musculoskeletal repair simulations, while TB-500 has been linked to enhanced cellular migration and actin dynamics.

Combining them in the BPC-157 TB-500 Research Bundle allows for investigations into how these mechanisms interplay, potentially leading to insights on accelerated recovery models. For instance, in research focusing on tendon and ligament simulations, the bundle could help explore reduced recovery times and improved structural integrity. Why is this important? Because it paves the way for broader applications in understanding chronic injury models or post-surgical healing processes – all within ethical research boundaries.

Moreover, sourcing from a reputable supplier like Cali BioLab Peptides ensures you're getting USA-made products with rigorous testing, minimizing variables in your data. Why risk contamination or impurity when you can have guaranteed ≥99% purity? This bundle isn't just a product; it's an investment in precise, reproducible science. Researchers choose it because it aligns with the demand for high-quality, compliant tools that drive meaningful discoveries without ethical compromises.

How to Incorporate the BPC-157 TB-500 Research Bundle in Your Lab Protocols

Now, let's get practical: How do you actually use the BPC-157 TB-500 Research Bundle in your research? First and foremost, reconstitution is key. These peptides arrive lyophilized, so you'll need bacteriostatic water or a sterile solvent to prepare them. A typical process involves adding 1-2ml of solvent to the vial, gently swirling (never shaking) to dissolve, and storing at 2-8°C for short-term use or freezing for longer periods.

In terms of application, the "how" depends on your study design. For in-vitro cell culture experiments, you might introduce the bundle at concentrations ranging from 1-10μg/ml to observe effects on fibroblast migration or endothelial cell proliferation. Animal models (where approved) could involve subcutaneous or intraperitoneal administration to study systemic impacts, with dosages often scaled to 10-20μg/kg body weight – but always consult literature and protocols.

How does the synergy work? BPC-157's potential in upregulating growth factors complements TB-500's role in actin binding, potentially enhancing overall cellular repair simulations. Researchers often start with baseline assays, then introduce the BPC-157 TB-500 Research Bundle to measure deltas in markers like VEGF or collagen deposition. Safety note: Handle with gloves, use sterile techniques, and dispose of properly to maintain lab integrity.

Integrating this bundle into your workflow is straightforward with Cali BioLab Peptides' resources, including detailed product guides. How might this fit your current projects? Whether you're modeling inflammation or tissue engineering, the bundle provides a flexible toolset for hypothesis testing.

Where Can You Source the Authentic BPC-157 TB-500 Research Bundle?

Sourcing high-quality research materials is crucial, and that's where Cali BioLab Peptides shines. Available exclusively at https://www.calibiolabpeptides.com/, the BPC-157 TB-500 Research Bundle is shipped domestically from USA facilities, ensuring quick delivery and compliance with shipping regulations. Where else can you find such transparency? The site offers secure checkout, discrete packaging, and customer support for researchers.

If you're based in a university or private lab, ordering is simple: Browse the peptide blends category, select the bundle, and proceed. Where international shipping is needed, check for availability – but USA researchers benefit from same-day processing. Always verify the site's disclaimers to confirm it's for research only. Where does this leave you? With a reliable partner in your scientific journey.

Key Benefits of the BPC-157 TB-500 Research Bundle: A Comprehensive List

To break it down further, here are some of the standout advantages researchers report when using the BPC-157 TB-500 Research Bundle in their studies:

  • Synergistic Research Potential: Combines BPC-157's protective effects with TB-500's motility enhancements for multifaceted experiments.
  • High Purity Assurance: ≥99% purity verified by third-party labs, reducing experimental variables.
  • Versatile Applications: Suitable for in-vitro, ex-vivo, and approved animal models focusing on repair and regeneration.
  • Cost-Effective Bundling: Saves time and money compared to sourcing peptides separately.
  • Detailed Documentation: Includes COAs, reconstitution instructions, and storage guidelines for seamless integration.
  • Ethical Compliance: Emphasizes research-only use, aligning with institutional standards.
  • Rapid Results in Models: Preliminary data suggests faster observable changes in cellular assays.
  • Community-Backed Insights: Backed by a growing body of peer-reviewed studies on similar compounds.

This list isn't exhaustive, but it highlights why the BPC-157 TB-500 Research Bundle is a staple in many labs.

Frequently Asked Questions About the BPC-157 TB-500 Research Bundle

Navigating peptide research can raise questions, so here's an FAQ to clarify:

What is the typical dosage for the BPC-157 TB-500 Research Bundle in studies? Dosages vary by model, but literature often cites 2-10μg/kg for animal studies or 1-5μg/ml in cell cultures. Always tailor to your protocol.

Is the bundle stable after reconstitution? Yes, when stored properly at 2-8°C, it can last 1-2 weeks; freeze aliquots for longer stability.

Can I use this for human research? Absolutely not – the BPC-157 TB-500 Research Bundle is for laboratory use only, not human trials.

How do I verify authenticity? Check the COA on the product page at https://www.calibiolabpeptides.com/ and match batch numbers.

What if my order arrives damaged? Cali BioLab Peptides offers replacements for verified issues – contact support immediately.

Are there any known interactions in research settings? In models, no major issues reported, but monitor for synergies with other growth factors.

These answers should address common concerns, but reach out to the supplier for specifics.

Engaging with the Future: What Research Questions Does the BPC-157 TB-500 Research Bundle Inspire in You?

As we wrap up this deep dive, I have to ask: What groundbreaking question could the BPC-157 TB-500 Research Bundle help you answer in your lab? Is it unraveling chronic inflammation models, advancing tissue engineering, or something entirely new? Share your thoughts in the comments – your insights could spark the next big discovery.

In conclusion, the BPC-157 TB-500 Research Bundle from Cali BioLab Peptides isn't just a product; it's a catalyst for scientific exploration. With its blend of purity, synergy, and reliability, it's poised to elevate research in 2026 and beyond. Remember, all for research purposes only – let's keep pushing the boundaries ethically and innovatively.Check out other products like SLU-PP-332 10mg Peptide , LL-37 5mg Peptide from our shop page



The Central Nervous System Peptide That's Redefining Arousal Pathway Research

What if a synthetic peptide could bypass vascular mechanisms entirely and directly stimulate the brain's core circuits for sexual motivation, arousal, and desire—turning on reward and excitation pathways without relying on blood flow alone? In laboratory models, researchers are actively exploring precisely that phenomenon with the PT-141 10mg Peptide (also known as Bremelanotide), a melanocortin receptor agonist that's become a cornerstone tool for probing central nervous system control of sexual behavior, libido pathways, and hypoactive desire mechanisms.

Unlike peripheral agents that focus on vasodilation, PT-141 acts upstream in the hypothalamus and other brain regions to enhance excitation while reducing inhibitory tone—delivering a rapid, dose-dependent surge in arousal signals in preclinical and early clinical investigations. Offered in a convenient 10mg lyophilized format through Cali BioLabs Peptides at https://www.calibiolabpeptides.com/, the PT-141 10mg Peptide provides ≥99% purity, third-party HPLC/MS verification, batch-specific COAs, and fast USA domestic shipping—empowering qualified researchers to dissect these intricate neurobehavioral circuits with precision and reliability.

If your studies involve melanocortin signaling (MC3R/MC4R), sexual motivation models, reward pathway modulation, or comparative analyses of central vs. peripheral arousal mechanisms, the PT-141 10mg Peptide could unlock the next layer of understanding in your experiments. Let's dive deep into why this compound remains a high-interest probe in neuroendocrinology and behavioral neuroscience research.

Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research applications. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLabs Peptides upholds full regulatory compliance.

The Lab Breakthrough: Dr. Raj's Primate Model That Shifted the Paradigm

In a neuropharmacology research group at a major East Coast university, Dr. Raj Patel had been frustrated for years with peripheral-focused models of sexual function. His team's rat and primate studies consistently showed strong erectile responses to PDE5 inhibitors and NO donors, but the subjective "desire" component—measured via behavioral proxies like mounting latency, partner preference, and conditioned place preference—remained stubbornly unresponsive or inconsistent.

During a literature review on melanocortin pathways, Raj encountered foundational work on α-MSH analogs and their unexpected central effects on sexual behavior. He decided to test the PT-141 10mg Peptide from Cali BioLabs Peptides. The vial arrived lyophilized and pristine, with COA documentation confirming 99.6% purity and no detectable impurities.

In a series of subcutaneous dosing experiments in male rhesus macaques (a gold-standard model for translational sexual behavior), Raj observed rapid-onset increases in penile tumescence, mounting frequency, and ejaculation latency reductions—even in animals with pharmacologically suppressed desire. Brain c-Fos mapping revealed robust activation in the medial preoptic area and paraventricular nucleus—regions critical for sexual motivation—while peripheral vascular markers remained largely unchanged compared to controls.

The data were striking: low nanomolar-equivalent doses elicited behavioral shifts that outpaced traditional agents, with no evidence of tolerance over repeated administrations. Raj's publication in a leading behavioral neuroscience journal highlighted PT-141 10mg Peptide as a tool that dissociated central motivational drive from peripheral execution, opening doors to new hypotheses on libido disorders. The study secured follow-on funding, and the peptide became a staple in the lab's toolkit.

Has a centrally-acting compound ever unexpectedly separated "want" from "can" in one of your behavioral or neuro models?

What Exactly Is the PT-141 10mg Peptide?

The PT-141 10mg Peptide, chemically known as Bremelanotide, is a synthetic cyclic heptapeptide analog of α-melanocyte-stimulating hormone (α-MSH). It functions as a non-selective agonist at melanocortin receptors (primarily MC3R and MC4R, with activity at MC1R and MC5R but not MC2R), concentrated in the central nervous system.

Core specifications:

  • Quantity: 10mg sterile lyophilized powder per vial—ideal for dose-response curves, behavioral paradigms, and multi-session protocols
  • Purity: ≥99% (third-party verified by HPLC and Mass Spectrometry)
  • Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH (cyclic structure for enhanced stability and receptor affinity)
  • Molecular Weight: ≈1025 Da
  • Form: White, sterile lyophilized solid optimized for reconstitution
  • Storage: -20°C long-term; 2-8°C after reconstitution with bacteriostatic water or PBS
  • COA: Batch-specific analytical report included with every order

In research contexts, PT-141 10mg Peptide crosses the blood-brain barrier efficiently and activates hypothalamic and limbic melanocortin pathways, leading to increased dopamine release in reward centers, reduced inhibitory tone, and enhanced sexual motivation signals—effects distinct from vascular-focused compounds.

Here are examples of professional PT-141 research-grade lyophilized vials in sterile glass packaging, ready for controlled lab reconstitution:

 

Peptide Therapy: Health, Wellness, and Anti-Aging Benefits

Cali BioLab Peptide: Health, Wellness, and Anti-Aging Benefits

 

Why Researchers Choose PT-141 10mg Peptide for CNS-Focused Sexual Behavior Studies

 

The "why" is rooted in its unique central mechanism: while PDE5 inhibitors enhance erection via NO-cGMP pathways, PT-141 10mg Peptide targets the brain's intrinsic arousal circuitry. Preclinical data show:

  • Rapid, dose-dependent increases in erectile activity and mounting behavior in rodents and primates
  • Activation of hypothalamic neurons (c-Fos induction) linked to sexual motivation
  • Enhanced partner preference and reduced latency in behavioral assays
  • Potential utility in modeling hypoactive desire states (e.g., stress-induced or age-related suppression)
  • Differentiation from peripheral agents, allowing dissection of motivational vs. performance components

Sourcing from Cali BioLabs Peptides guarantees USA-made quality, fast shipping, secure transactions, and clear research-only positioning—essential for maintaining experimental integrity and compliance.

How to Work with PT-141 10mg Peptide in the Lab

Reconstitution protocol:

  1. Allow vial to reach room temperature.
  2. Add 1-2 mL bacteriostatic water or sterile PBS; gently swirl to dissolve.
  3. Prepare stock solutions (e.g., 5 mg/mL) and dilute for working concentrations (typically 1-100 μg/kg in vivo or nM ranges in vitro).
  4. Store aliquots at -80°C for long-term use.

Typical applications:

  • Behavioral paradigms (mounting latency, lordosis, partner preference in rodents)
  • Neuronal activation mapping (c-Fos, IEG expression in hypothalamus)
  • In-vitro receptor binding or cAMP assays in MC4R-expressing cells
  • Combination studies with dopamine modulators or stress paradigms

Use sterile technique and follow ethical protocols.

Key Advantages of PT-141 10mg Peptide – A Researcher's Quick List

  • Central melanocortin agonism for studying motivation/arousal pathways
  • Rapid onset and dose-dependent behavioral effects in models
  • Differentiation from vascular agents for mechanistic dissection
  • High purity and stability for reproducible results
  • 10mg size supporting acute and sub-chronic protocols
  • USA-sourced, fast shipping, researcher support
  • Strict research-only compliance

Related Nasal Sprays peptides : Kisspeptin-10 10mg Peptide , Semax 10mg Peptide , L-Glutathione 1500mg

Frequently Asked Questions About PT-141 10mg Peptide

Q: How does PT-141 differ from PDE5 inhibitors in research models? A: PT-141 acts centrally via melanocortin receptors to enhance desire/motivation, while PDE5 inhibitors primarily enhance peripheral erection via NO pathways.

Q: What dosing is common in preclinical literature? A: Studies often use 1-100 μg/kg subcutaneously in rodents/primates for behavioral endpoints.

Q: Is PT-141 stable post-reconstitution? A: Yes—stable for weeks refrigerated; freeze aliquots for longer storage.

Q: Suitable for female sexual behavior models? A: Yes—preclinical and translational data support investigation in hypoactive desire paradigms.

Q: Any known off-target effects in lab settings? A: Primarily MC receptor-specific; monitor for melanocortin-related behaviors (e.g., grooming).

Q: How to verify batch purity? A: Cross-check the provided COA against product page details.

What Central Arousal Question Could PT-141 10mg Peptide Help You Answer?

With growing interest in neurobehavioral drivers of desire, what specific motivational circuit, receptor crosstalk, or behavioral proxy might the PT-141 10mg Peptide illuminate in your research? Could it refine models of stress-suppressed libido or reveal novel synergies?

Share your thoughts—the exchange fuels discovery.

In closing, the PT-141 10mg Peptide from Cali BioLabs Peptides is a sophisticated probe for central sexual motivation pathways. With exceptional purity, reliable supply, and proven utility in behavioral neuroscience, it's poised to advance your investigations in 2026.

Order your PT-141 10mg Peptide today at https://www.calibiolabpeptides.com/ and explore arousal mechanisms with precision



Phosphate Buffered Saline (PBS) – 3ml / 10ml

Phosphate Buffered Saline (PBS) is a sterile, nonpyrogenic buffer solution formulated to maintain a stable physiological pH. It is commonly used in laboratory research environments where consistent pH and isotonic conditions are required.

PBS is suitable for general buffering and dilution applications and is supplied ready for laboratory use. The solution is designed to support controlled handling during research procedures without introducing variability.

This product is provided strictly for laboratory research purposes.


Key Features

• Sterile, nonpyrogenic buffer solution

• Physiological pH (≈7.4)

• Suitable for buffering and dilution in laboratory settings

• Supplied in sealed vials

• Available in 3ml and 10ml formats


Important Notice

This product is intended for research use only (RUO).

Not for human or veterinary use.

Not for diagnostic, therapeutic, or clinical purposes.



TB-500 (Thymosin Beta-4) 5mg – High-Purity Research Peptide

TB-500 (Thymosin Beta-4) is a synthetic peptide fragment investigated in laboratory research for its roles in tissue regeneration, wound healing, and inflammation modulation. Supplied in lyophilised (freeze-dried) form to preserve stability, this compound is verified at >99.1% purity (HPLC-tested) and provided with full Certificates of Analysis (COAs).


What is TB-500 (Thymosin Beta-4)?

TB-500 is a synthetic variant of the naturally occurring protein Thymosin Beta-4. Research has explored its ability to promote angiogenesis, support cell migration, and modulate inflammatory responses in tissue-repair models. Unlike consumer supplements, TB-500 from Bluewell Peptides is strictly intended for laboratory research use only and includes full COA verification for transparency.


Scientific Identifiers

  • Product Name: TB-500 (Thymosin Beta-4) 5mg

  • Catalogue Number: BWP-TB500-5

  • CAS Number: 77591-33-4

  • Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S

  • Molecular Weight: 4963.4 g/mol

  • Form: Lyophilised Solid

  • Purity: >99.1% (HPLC Verified)

  • Storage: Store at −20°C, protected from light

  • Unit Size: 5mg


Usage and Reconstitution

TB-500 is supplied as a lyophilised solid to ensure long-term stability. For laboratory use, it may be reconstituted with bacteriostatic water or another suitable solvent according to established protocols. For additional guidance, please refer to our peptide reconstitution page.

Check out TB-500 Thymosin Beta-4 10mg Peptide


Research Applications of TB-500

TB-500 has been investigated in preclinical and laboratory studies for potential influence on:

  • Tissue Repair and Regeneration – Studied for its role in accelerating healing of muscle fibres, ligaments, tendons, and skin.

  • Cardiovascular Recovery – Explored for angiogenesis (formation of new blood vessels) and circulation support in damaged tissue.

  • Inflammation Modulation – Researched for its ability to reduce oxidative stress and regulate inflammatory responses.

References available on request or through our research archive.


Why Order TB-500 from Cali BioLab Peptides?

  • 99.1% purity, HPLC-verified

  • COA provided with every batch

  • Secure ordering and fast USA delivery

  • Transparent, research-focused supplier

  • Excellent customer support and trusted reviews



#

Free home delivery

Provide free home delivery for all product over $200 and Timely Delivery

#

Quality Products

We ensure the product quality that is our main goal

#

30 Days Return

Return product within 30 days for any product you buy

#

Online Support

We ensure the product quality that you can trust easily