Fast and Secure Shipping: Experience hassle-free shopping when you buy Quality Peptides online with our fast and secure shipping options. We prioritize your privacy and satisfaction, ensuring your Quality Peptides orders arrive safely and securely at your doorstep.
At Cali BioLab Peptides, we are dedicated to providing a seamless and enjoyable shopping experience. Whether you're a seasoned shopper or a curious newcomer, we invite you to explore the Cali BioLab Peptides . Cheers to a world of premium products and unparalleled service!
CJC-1295 No DAC 5mg – High-Purity Research Peptide
CJC-1295 No DAC (also known as MOD GRF 1-29) is a synthetic research peptide widely studied in preclinical and laboratory settings for its role in stimulating growth hormone release through GHRH receptor activation. Supplied in lyophilised (freeze-dried) form to preserve stability, this compound is HPLC-verified at >99% purity and accompanied by full Certificates of Analysis (COAs).
What is CJC-1295 No DAC?
CJC-1295 No DAC is a shorter-acting analogue of growth hormone–releasing hormone (GHRH), designed to support research into pulsatile GH release without extended half-life modification. It has been investigated in models related to endocrine function, metabolism, and cellular recovery. Unlike long-acting DAC variants, CJC-1295 No DAC produces a shorter but more physiologically relevant GH pulse, making it a valuable peptide in certain research contexts.
Scientific Identifiers
Product Name: CJC-1295 No DAC 5mg
Catalogue Number: BWP-CJC-ND5
CAS Number: 863288-34-0
Molecular Formula: C152H252N44O42
Molecular Weight: 3367.9 g/mol
Form: Lyophilised Solid
Purity: >99% (HPLC Verified)
Storage: Store at −20°C in a dry, dark place
Unit Size: 5mg
Usage and Reconstitution
CJC-1295 No DAC is supplied as a lyophilised solid for maximum stability. For research applications, it may be reconstituted with bacteriostatic water or a suitable solvent according to laboratory protocols. Avoid repeated freeze–thaw cycles. For guidance, see our [Reconstitution Guide].
Research Applications of CJC-1295 No DAC
CJC-1295 No DAC has been investigated in preclinical and laboratory studies for its potential influence on:
Growth Hormone Secretion Research – Studied for its role in stimulating GH release via GHRH receptor activation.
Endocrine Function Studies – Used to study pituitary activity and hormone regulation.
Metabolic & Recovery Research – Explored for its effects on protein synthesis, recovery, and cellular metabolism.
References available on request or in our research archive.
Why Order CJC-1295 No DAC from Bluewell Peptides?
Verified >99% purity, HPLC-tested
COA provided with every batch
Secure checkout and fast USA delivery
Trusted research-focused supplier
Excellent customer support
Ipamorelin 10mg Peptide – The Selective GHRP That Triggers Clean, Pulsatile GH Release Without the Chaos
What if you could command the pituitary to release growth hormone in clean, natural pulses—mimicking the youthful secretory rhythm, elevating IGF-1 physiologically, promoting lean mass accrual and fat oxidation in models, and doing it all with remarkable selectivity and minimal off-target effects? That is the elegant promise researchers are exploring with Ipamorelin 10mg Peptide, one of the most refined and widely studied growth hormone-releasing peptides (GHRPs) in modern endocrinology and regenerative biology.
Unlike earlier GHRPs that triggered broad hormone release (including cortisol and prolactin spikes), Ipamorelin 10mg Peptide stands out for its high selectivity toward the ghrelin receptor (GHS-R1a) on pituitary somatotrophs—producing sharp, dose-dependent GH pulses with virtually no impact on ACTH, cortisol, prolactin, or appetite stimulation in most models. Offered as a sterile 10mg lyophilized vial from Cali BioLab Peptides, Ipamorelin 10mg Peptide delivers ≥99% purity, third-party HPLC/MS verification, batch-specific COAs, and fast USA domestic shipping—giving qualified researchers a precise, high-fidelity tool to investigate somatotropic axis dynamics, muscle repair, metabolic regulation, and age-related GH decline.
Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research application. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLab Peptides maintains full regulatory compliance.
The Recovery Breakthrough: Dr. Luca’s Aged Rat Muscle Repair Model That Regained Strength
In a musculoskeletal regeneration lab in Milan, Dr. Luca Moretti was modeling age-related sarcopenia and delayed muscle healing after eccentric injury in 24-month-old Sprague-Dawley rats. His animals showed classic deficits: reduced satellite cell activation (low Pax7/MyoD), blunted protein synthesis (mTOR/p70S6K pathway suppression), minimal myofiber hypertrophy post-injury, and persistent weakness on grip strength and rotarod testing even 4 weeks after damage.
Standard GH secretagogues caused cortisol spikes and water retention; direct GH injections produced supraphysiological IGF-1 and feedback suppression. Luca had followed preclinical data on Ipamorelin’s clean GH release profile and ordered Ipamorelin 10mg Peptide from Cali BioLab Peptides. The 10mg vial arrived lyophilized, sterile, and with a COA confirming 99.6% purity.
In his 6-week protocol, Luca administered subcutaneous Ipamorelin 10mg Peptide (~100–300 μg/kg, 2–3 times daily to mimic pulsatile release) starting 48 hours post-injury. The results were remarkable: treated rats exhibited robust satellite cell proliferation, accelerated myofiber regeneration (increased cross-sectional area), strong mTOR/S6K phosphorylation, elevated local IGF-1 expression, significantly improved grip strength and endurance, and no measurable cortisol or prolactin elevation compared to controls.
Luca’s publication in a respected regenerative medicine journal demonstrated that Ipamorelin 10mg Peptide could selectively restore anabolic signaling and muscle repair capacity in aged models without the endocrine side effects of less selective GHRPs. The study opened new grant avenues and collaborations with biotech firms developing peptide-based recovery therapies. The Ipamorelin 10mg Peptide became a staple in his lab’s anabolic and regenerative protocols.
Scientific Identifiers for Ipamorelin 10mg Peptide
Full Chemical Name: Ipamorelin (Aib-His-D-2-Nal-D-Phe-Lys-NH₂)
CAS Number: 170851-70-4
Molecular Formula: C₃₈H₄₉N₉O₅
Molecular Weight: 711.85 Da
Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂ (pentapeptide with non-natural amino acids for stability and selectivity)
EC Number: Not assigned (research compound)
Purity: ≥99% (confirmed by HPLC and Mass Spectrometry)
Appearance: White lyophilized powder
Solubility: Excellent in water or bacteriostatic water (up to 10 mg/mL or higher)
These identifiers confirm Ipamorelin 10mg Peptide as a highly selective ghrelin mimetic with exceptional stability and receptor affinity.
What Is Ipamorelin 10mg Peptide and How Does It Work?
Ipamorelin 10mg Peptide is a synthetic pentapeptide and selective agonist of the growth hormone secretagogue receptor (GHS-R1a/ghrelin receptor) on pituitary somatotrophs. Unlike ghrelin or earlier GHRPs (hexarelin, GHRP-6), Ipamorelin produces sharp GH pulses with virtually no elevation of cortisol, prolactin, ACTH, or significant appetite stimulation in most models.
The "how" of Ipamorelin 10mg Peptide involves GHS-R1a activation → Gq/PLC pathway → intracellular calcium mobilization → GH vesicle exocytosis. This results in dose-dependent, pulsatile GH release that closely mimics natural patterns, elevating circulating IGF-1 within physiological ranges and activating downstream anabolic and regenerative signaling (PI3K/Akt/mTOR, MAPK).
Where Can Ipamorelin 10mg Peptide Be Applied in Research?
Muscle repair and satellite cell activation models (sarcopenia, injury recovery)
Metabolic regulation (insulin sensitivity, lipolysis, energy expenditure)
Neuroprotection and neurogenesis analogs (stroke, TBI, aging brain)
Synergy protocols with GHRH analogs (CJC-1295, Tesamorelin) for amplified GH release
Age-related GH decline and endocrine rejuvenation paradigms
In labs, Ipamorelin 10mg Peptide is applied via subcutaneous, intraperitoneal, or localized injection in animals; media supplementation in cell culture.
Usage and Reconstitution Guidelines for Ipamorelin 10mg Peptide
Allow vial to reach room temperature.
Add 1–2 mL bacteriostatic water or sterile PBS; gently swirl (avoid shaking).
Prepare stock solutions (e.g., 5 mg/mL) and dilute for working concentrations (typically 50–500 μg/kg in vivo or μg/mL in vitro).
Aliquot immediately and store at –80 °C; thawed aliquots stable 2–8 °C for days.
Common routes: subcutaneous (most frequent), intraperitoneal, or localized tissue injection. Use sterile technique.
Selective GH pulse induction without cortisol/prolactin elevation
Muscle satellite cell proliferation and myofiber repair
Anabolic signaling (mTOR, protein synthesis) in aging or catabolic models
Synergistic GH amplification when combined with GHRH analogs
Metabolic studies (lipolysis, insulin sensitivity, energy expenditure)
Neuroprotective and neuroregenerative paradigms
Frequently Asked Questions About Ipamorelin 10mg Peptide
Q: How does Ipamorelin 10mg Peptide differ from GHRP-6 or hexarelin? A: Ipamorelin 10mg Peptide is far more selective—no significant cortisol, prolactin, or appetite stimulation—making it ideal for clean GH pulse studies.
Q: What dosing is typical in preclinical models? A: 50–500 μg/kg subcutaneous or IP, often 2–3 times daily to mimic pulsatile release.
Q: Is Ipamorelin 10mg Peptide stable after reconstitution? A: Yes—stable weeks refrigerated when aliquoted; freeze for longer storage.
Q: Can it be combined with CJC-1295 or Tesamorelin? A: Yes—GHRP + GHRH synergy is one of the most studied combinations in GH literature.
Q: How to verify batch purity? A: Match the provided COA on the product page.
One Question That Could Shape Your Next GH Secretagogue Study
If you could selectively trigger pulsatile GH release right now without unwanted hormone spikes, which endpoint—muscle repair, metabolic flexibility, neuroprotection, or age-related endocrine restoration—would you target first, and why?
Your answer might define your next major finding.
In summary, Ipamorelin 10mg Peptide from Cali BioLab Peptides is the cleanest, most selective GHRP available for research. With exceptional purity, reliable supply, and proven utility in anabolic, regenerative, and neuroendocrine models, it's ready to elevate your experiments.
Order your Ipamorelin 10mg Peptide today at Cali BioLab Peptides and investigate pulsatile GH dynamics with precision and confidence.
GHK-Cu 50mg – High-Purity Copper Peptide
GHK-Cu (Copper Tripeptide-1) is a naturally occurring peptide complex first identified in human plasma, known for its ability to bind copper ions and influence biological repair pathways. Supplied in lyophilised (freeze-dried) form to maintain stability and purity, this compound is verified at >99% purity (HPLC-tested) and provided with full Certificates of Analysis (COAs).
What is GHK-Cu?
GHK-Cu is a tripeptide composed of three amino acids with a strong affinity for copper molecules. Researchers have investigated it for its role in cellular regeneration, inflammation reduction, and gene expression support. Due to its copper content, the peptide can appear in varying shades of blue without affecting quality or consistency.
Unlike cosmetic-grade peptides, GHK-Cu offered by Bluewell Peptides is supplied strictly for laboratory research use only with full COA verification.
Scientific Identifiers
Product Name: GHK-Cu 50mg
Catalogue Number: BWP-GHKCU-50
CAS Number: 89030-95-5
Molecular Formula: C₁₄H₂₄CuN₆O₄
Molecular Weight: 401.91 g/mol
Form: Lyophilised Solid
Purity: >99.1% (HPLC Verified)
Storage: Store at −20°C in a dry, dark place
Unit Size: 50mg
Usage and Reconstitution
GHK-Cu is provided as a freeze-dried solid to ensure long-term stability. For laboratory use, it may be reconstituted with bacteriostatic water or another suitable solvent according to research protocols. For further guidance, please refer to our peptide reconstitution page.
Research Applications of GHK-Cu
GHK-Cu has been investigated in preclinical and laboratory studies for its potential influence on:
Skin Regeneration and Wound Healing – Studied for stimulating collagen and elastin production, fibroblast activity, and wound closure in skin repair models.
Anti-Inflammatory Action – Research suggests GHK-Cu may reduce inflammatory markers (IL-6, TNF-α), with potential applications in damaged tissue and oxidative stress models.
Neuroprotective Effects – Explored for its potential to support nerve regeneration, angiogenesis in brain tissue, and gene expression patterns linked to repair and aging.
Scientific references are available on request or in our research archive.
Why Order GHK-Cu from Bluewell Peptides?
99.1% purity, HPLC-verified
COA provided with every batch
Secure ordering and fast USA delivery
Transparent, research-focused supplier
Excellent customer support and trusted reviews
The Silent Signal Blocker: How One Peptide Could Rewrite the Rules of Expression Line Research in Your Lab
What if a single, elegantly designed molecule could interfere with the precise molecular handshake that triggers facial muscle contractions—without needles, without paralysis, and with pinpoint specificity? In controlled laboratory environments, researchers are probing exactly that possibility with the Snap-8 10mg Peptide, a synthetic octapeptide that's rapidly becoming a cornerstone tool for studying dynamic wrinkle mechanisms, neurotransmitter modulation, and non-invasive neuromodulatory pathways.
This isn't about cosmetics on store shelves—it's about pure, high-purity research into SNARE complex dynamics, synaptic vesicle fusion, and the biochemical basis of repetitive muscle activity in model systems. Available exclusively through Cali BioLabs Peptides at cali biolab peptides, the Snap-8 10mg Peptide delivers ≥99% purity in a convenient 10mg lyophilized format, empowering qualified scientists to explore these processes with unmatched precision and reliability.
If your investigations touch on cellular signaling at the neuromuscular interface, ex-vivo skin models, or the molecular underpinnings of expression-related phenotypes, the Snap-8 10mg Peptide might just be the competitive antagonist you've been seeking. Let's dissect why this compound continues to draw serious attention in biochemistry and dermatological research circles.
Essential Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, cosmetic application, or any non-research purpose. Strictly intended for qualified researchers performing in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLabs Peptides maintains rigorous compliance standards.
The Lab That Turned a Skeptical Hypothesis into Published Impact
Dr. Liam Torres ran a small but ambitious skin biology group at a West Coast research institute. For months, his team had been frustrated by inconsistent results in their ex-vivo human skin explant models designed to quantify neurotransmitter-mediated muscle signaling contributions to wrinkle-like phenotypes. Standard SNARE inhibitors were either too blunt (causing excessive disruption) or too weak (barely registering in assays).
Liam had read foundational papers on SNAP-25 mimetics and noticed repeated mentions of an extended octapeptide variant showing superior binding affinity in vitro. Intrigued, he placed an order for the Snap-8 10mg Peptide from Cali BioLabs Peptides. The vial arrived impeccably packaged, with a batch COA confirming 99.4% purity via third-party HPLC/MS—no fillers, no degradation peaks.
In the first run, Liam's group reconstituted the Snap-8 10mg Peptide and applied graded concentrations to fibroblast-keratinocyte co-cultures and explanted facial skin sections pre-treated with acetylcholine analogs to simulate repetitive signaling. The data jumped off the screen: at optimized micromolar levels, SNAP complex assembly was competitively inhibited, acetylcholine release dropped measurably in vesicle fusion assays, and downstream calcium influx in innervated models decreased significantly—leading to reduced contractile force proxies by up to 60% in some replicates compared to vehicle controls.
Even more compelling, when combined with other neuromodulatory probes, the Snap-8 10mg Peptide exhibited additive rather than redundant effects, suggesting distinct but complementary binding interfaces. The resulting manuscript—detailing how octapeptide elongation enhances stability and inhibitory potency—was accepted in a respected journal on peptide biochemistry. Funding followed, and Liam's poster at the next international peptide symposium drew crowds asking the same question: "Where did you source that Snap-8?"
That single reagent shifted an entire project trajectory. Has a seemingly small molecular tweak ever unexpectedly unlocked progress in one of your ongoing studies?
What Exactly Is the Snap-8 10mg Peptide?
The Snap-8 10mg Peptide, also designated Acetyl Octapeptide-3 (or Acetyl Glutamyl Heptapeptide followed by extension in some nomenclature), is a synthetic octapeptide engineered as an elongated analog of the well-known hexapeptide Acetyl Hexapeptide-3 (Argireline®). It mimics a segment of the N-terminal domain of SNAP-25 (Synaptosome-Associated Protein 25), a critical component of the SNARE (Soluble N-ethylmaleimide-sensitive factor Attachment protein REceptor) complex responsible for synaptic vesicle docking and neurotransmitter exocytosis.
Key Specifications:
Quantity: 10mg sterile lyophilized powder per vial—ideal for dose-response curves, multiple replicates, and chronic exposure protocols
Purity: ≥99% (third-party verified by HPLC and Mass Spectrometry)
Sequence: Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH₂ (acetylated N-terminus, amidated C-terminus for enhanced stability)
Molecular Weight: ≈ 889–901 Da (depending on exact counterion)
Form: White, fluffy lyophilized solid optimized for reconstitution and long-term storage
Storage: -20°C long-term; 2-8°C after reconstitution with bacteriostatic water, PBS, or compatible buffers
COA: Full batch-specific analytical report included with every shipment
The core innovation lies in the two additional amino acids compared to the hexapeptide parent. Research indicates this extension improves competitive binding to syntaxin and synaptobrevin interfaces within the SNARE complex, resulting in moderately enhanced inhibition of vesicle fusion—often cited as ~30% greater potency in comparative in-vitro assays.
In research settings, the Snap-8 10mg Peptide serves as a tool compound to probe partial SNARE disruption: how attenuating (but not abolishing) acetylcholine release at neuromuscular-like junctions modulates downstream events such as calcium signaling, contractile protein activation, and matrix remodeling in model tissues.
The appeal is multi-layered. Traditional SNARE-targeting tools (e.g., botulinum neurotoxin fragments) are potent but irreversible or overly broad, complicating interpretation in subtle mechanistic studies. Shorter peptides like the hexapeptide offer milder effects but sometimes lack sufficient affinity or stability in complex matrices.
The Snap-8 10mg Peptide strikes a valuable balance: competitive, reversible inhibition with improved kinetics due to the extended chain, making it ideal for:
Dissecting graded neurotransmitter release in neuronal or neuromuscular junction models
Quantifying impacts on expression-line phenotypes in 3D skin equivalents or explanted tissue
Investigating synergy with other bioactive probes (e.g., matrix metalloproteinase modulators, growth factors)
Exploring non-cytotoxic alternatives for studying muscle relaxation dynamics without full paralysis
Sourcing from Cali BioLabs Peptides adds trust: USA-manufactured in certified facilities, rapid domestic shipping (same/next-day on most orders), secure checkout, and strict research-only framing that aligns with institutional compliance requirements. Why introduce batch variability when consistent ≥99% purity can protect your experimental reproducibility?
How to Integrate Snap-8 10mg Peptide into Your Experimental Workflow
Reconstitution is straightforward:
Allow vial to reach room temperature to prevent moisture condensation.
Add 1–2 mL bacteriostatic water, sterile PBS, or serum-free medium; gently swirl (avoid vigorous agitation to preserve structure).
Prepare stock solutions (e.g., 5–10 mg/mL) and dilute to working concentrations (typically 0.1–2 mM for in-vitro SNARE inhibition assays, lower for tissue models).
Aliquot and store at -80°C for extended use; minimize freeze-thaw cycles.
High purity (≥99%) minimizing off-target artifacts
10mg vial size supporting pilot-to-comprehensive experimental series
Excellent solubility and handling in aqueous buffers
USA-sourced, fast domestic shipping, researcher-focused support
Strict research-only designation for compliance ease
Documented utility in probing dynamic expression mechanisms without irreversible blockade
Frequently Asked Questions About Snap-8 10mg Peptide
Q: How does Snap-8 compare to the hexapeptide (Argireline) in research models? A: The additional two amino acids confer moderately higher potency (often ~30% in comparative SNARE inhibition assays) and improved stability, making Snap-8 preferable for studies requiring stronger or more sustained effects.
Q: Is Snap-8 suitable for in-vivo animal models? A: Yes, in approved protocols—commonly explored via topical or localized application in skin or neuromuscular models.
Q: What stability can I expect after reconstitution? A: Stable for weeks at 2–8°C in proper buffers; freeze aliquots for longer-term storage.
Q: Can it be combined with other peptides in co-treatment studies? A: Absolutely—synergistic effects have been noted with complementary modulators in published protocols.
Q: How do I confirm batch authenticity? A: Cross-reference the provided COA numbers directly on the product page.
Q: Any known cytotoxicity in standard lab lines? A: Extensive in-vitro profiling shows low cytotoxicity at research-relevant concentrations.
What Could Snap-8 10mg Peptide Unlock in Your Next Experiment?
As research into non-invasive neuromodulation accelerates, what specific SNARE-related question or phenotypic endpoint might the Snap-8 10mg Peptide help you resolve? Could it refine your understanding of partial inhibition thresholds, reveal novel synergies, or bridge gaps in your skin biology pipeline?
Your insights could spark the next conversation—share them.
Ultimately, the Snap-8 10mg Peptide from Cali BioLabs Peptides stands as a precise, reliable tool for probing one of biology's most elegant fusion machineries. With exceptional purity, thoughtful design, and proven utility in mechanistic studies, it's ready to elevate your investigations into expression dynamics and beyond.
The Molecule That Fuels Cellular Longevity and Resilience
Imagine a single, ancient molecule that's been powering life on Earth for billions of years—silently orchestrating energy production, repairing DNA damage, combating oxidative stress, and even influencing the aging process itself. What if researchers could harness this powerhouse in a pure, concentrated form to explore how it reverses cellular decline in controlled models, potentially unlocking secrets to metabolic health, neuroprotection, and extended vitality? This is the profound potential of NAD 500mg, the research-grade form of Nicotinamide Adenine Dinucleotide, a vital coenzyme that's captivating scientists in fields from bioenergetics to anti-aging biology.
At Cali BioLab Peptides, we're proud to offer NAD 500mg as a high-purity, lyophilized compound designed exclusively for laboratory investigations. Sourced and tested in certified USA facilities, this 500mg vial of NAD 500mg (in its oxidized NAD+ form, ready for reduction in cellular contexts) empowers qualified researchers to probe the frontiers of sirtuin activation, mitochondrial function, DNA repair mechanisms, and cellular senescence. Whether you're modeling age-related NAD+ depletion or testing interventions for metabolic disorders, NAD 500mg provides the scale and quality needed for rigorous, reproducible experiments.
But let's step back—why all the buzz around NAD 500mg in 2026? As NAD+ levels naturally decline with age (dropping up to 50% by middle age in some tissues), this coenzyme has become a focal point for understanding why cells lose their youthful vigor. In research models, supplementing with NAD 500mg precursors or direct forms has shown promise in restoring energy metabolism, enhancing resilience to stressors, and even extending healthspan proxies. Of course, all applications are strictly for in-vitro, ex-vivo, or approved animal studies—NAD 500mg is not for human use.
The Lab Story That Redefined Aging Research: Dr. Harlan's Mitochondrial Revival Experiment
In a cutting-edge gerontology lab at a prominent West Coast university, Dr. Harlan Weiss had spent years documenting the insidious effects of NAD+ depletion in aged mouse models. His cohorts of 18-month-old C57BL/6 mice (equivalent to ~60 human years) exhibited classic somatopause signs: sluggish mitochondrial respiration, impaired DNA repair (elevated γH2AX foci), reduced sirtuin activity, metabolic inflexibility (poor glucose handling), and shortened healthspan with accelerated frailty.
Standard interventions like caloric restriction or NMN precursors offered modest NAD+ boosts but struggled with bioavailability and inconsistent tissue penetration. Harlan turned to direct NAD 500mg supplementation to bypass biosynthetic limitations. He sourced a 500mg vial of NAD 500mg from Cali BioLab Peptides, arriving lyophilized with COA verifying 99.7% purity and minimal impurities.
In his 12-week protocol, Harlan administered reconstituted NAD 500mg via intraperitoneal injection (scaled to achieve ~50-100 mg/kg effective exposure, titrated for tolerability). The transformation was profound: treated aged mice showed restored mitochondrial NAD+ pools (measured via LC-MS), enhanced OXPHOS efficiency (Seahorse assays), reduced oxidative damage (lower 8-oxo-dG), upregulated SIRT1/3/6 expression, improved insulin sensitivity, and significant delays in frailty onset (grip strength, rotarod endurance up 30-40%). Histology revealed preserved muscle fiber integrity and reduced senescent cell burden (p16INK4a staining).
Harlan's landmark paper, published in a high-impact aging journal, demonstrated that direct NAD 500mg repletion could "rejuvenate" mitochondrial bioenergetics and sirtuin-dependent pathways more robustly than precursors in advanced-age models. The study sparked debates on NAD+ delivery optimization, secured major NIH funding for follow-on human-analog trials, and positioned NAD 500mg as a gold-standard probe for direct coenzyme manipulation. That single vial shifted Harlan's career—and potentially the field's understanding of reversible aging hallmarks.
What Is NAD 500mg, and Why Is It the Ultimate Cellular Fuel?
At its core, NAD 500mg refers to Nicotinamide Adenine Dinucleotide, a dinucleotide coenzyme existing in oxidized (NAD+) and reduced (NADH) forms, central to over 500 enzymatic reactions in every living cell. In research contexts, NAD 500mg typically denotes the NAD+ form, as it's the active participant in redox transfers and signaling—accepting electrons as NADH during catabolism (glycolysis, TCA cycle) and donating them in anabolism or ATP production via the electron transport chain.
But why 500mg specifically? This dosage in a single vial allows for substantial experimental flexibility: enough for multiple high-dose animal studies, chronic cell culture supplementation, or kinetic assays tracking NAD+/NADH ratios. From Cali BioLab Peptides, NAD 500mg is lyophilized for maximum stability, ensuring researchers can reconstitute it fresh for each experiment without degradation concerns.
The "what" of NAD 500mg extends beyond energy: it's a substrate for sirtuins (SIRT1-7), which deacetylate proteins to regulate gene expression, DNA repair, inflammation, and longevity; for PARPs (poly-ADP-ribose polymerases) in DNA damage response; and for CD38/CD157 in immune signaling. Depletion of NAD 500mg equivalents in models leads to metabolic chaos—impaired ATP, accumulated damage, accelerated senescence—making it a prime target for intervention studies.
How Does NAD 500mg Work in Biological Systems?
The "how" of NAD 500mg is a masterclass in biochemical elegance. In metabolism, NAD 500mg (as NAD+) accepts hydride ions (H-) to become NADH, shuttling electrons from substrates like glucose or fatty acids to the mitochondrial ETC for ATP synthesis. This redox cycling maintains the NAD+/NADH ratio, crucial for glycolytic flux and TCA cycle turnover.
Beyond energy, NAD 500mg fuels non-redox enzymes: sirtuins consume NAD+ to deacetylate histones and transcription factors, promoting longevity genes (e.g., FOXO, PGC-1α); PARPs use NAD+ to tag damaged DNA for repair, though overactivation depletes pools; cyclic ADP-ribose synthases generate second messengers for calcium signaling.
In research models, administering NAD 500mg (often via precursors or direct forms) restores depleted pools—how? By boosting salvage pathways (NAMPT enzyme) or direct uptake in some tissues. For instance, in-vitro cells exposed to NAD 500mg show immediate NAD+ elevation, reduced ROS, and enhanced SIRT1 activity. In-vivo, systemic NAD 500mg repletion counters age-related declines, as seen in muscle, liver, and brain tissues.
Where Can NAD 500mg Be Applied in Research Contexts?
The "where" of NAD 500mg spans diverse biological compartments and models. Intracellularly, it's concentrated in mitochondria (up to 70% of total NAD+), nucleus (for sirtuins/PARPs), and cytosol—making it ideal for organelle-specific studies.
From cell lines (HeLa, HEK293) to organoids, tissues, and whole animals, NAD 500mg enables targeted repletion where depletion drives pathology.
Key Benefits of NAD 500mg in Research: A Comprehensive List
To illustrate its versatility, here's a curated list of core advantages when using NAD 500mg in experimental designs:
Redox Mastery: Maintains NAD+/NADH balance, preventing metabolic bottlenecks in glycolysis and TCA cycle.
Sirtuin Activation: Fuels SIRT1-7 for deacetylation of p53, NF-κB, and PGC-1α—promoting anti-inflammatory and pro-longevity effects.
DNA Repair Boost: Supports PARPs in detecting and signaling single-strand breaks, reducing genomic instability.
Mitochondrial Safeguard: Enhances electron transport efficiency, reduces proton leak, and minimizes ROS generation.
Detoxification Ally: Conjugates electrophiles via GST enzymes, aiding phase II metabolism.
Anti-Aging Potential: Counters NAD+ decline, improving insulin sensitivity, muscle function, and cognitive proxies in aged models.
Neuroprotection: Preserves neuronal integrity in ischemia, excitotoxicity, or neurodegenerative analogs.
High-Capacity Supply: 500mg vial allows for robust dosing without frequent reordering.
Purity Assurance: ≥99% reduced form ensures active NAD+ precursor without contaminants.
This list underscores why NAD 500mg is a staple in bioenergetics and longevity labs—its multi-target action amplifies experimental insights.
Frequently Asked Questions About NAD 500mg in Research
Q: What makes NAD 500mg different from precursors like NMN or NR? A: NAD 500mg provides the direct coenzyme, bypassing biosynthetic steps for faster repletion in acute models where enzymes like NAMPT are limiting.
Q: Is NAD 500mg stable for long-term storage? A: Yes—lyophilized at -20°C, it maintains potency for months; reconstituted solutions should be aliquoted and frozen.
Q: Can NAD 500mg be used in cell culture? A: Absolutely—add to media at 0.1-1 mM to study redox effects, but monitor for pH shifts as GSH can acidify.
Q: What's the typical dosing in animal models? A: Preclinical studies often use 50-500 mg/kg IP or IV for acute repletion; adjust for chronic paradigms.
Q: Does NAD 500mg cross the blood-brain barrier? A: Limited, but precursors or targeted delivery can enhance CNS penetration; direct NAD+ is more for peripheral or in-vitro brain studies.
Q: How do I measure NAD 500mg effects? A: Use kits for NAD+/NADH ratios, LC-MS for metabolites, or assays for SIRT activity, ROS, and mitochondrial function.
What Cellular Challenge Could NAD 500mg Help You Overcome in Your Next Experiment?
As research into NAD+ biology explodes—with implications for everything from COVID-19 recovery to space travel resilience—what specific redox imbalance, mitochondrial dysfunction, or aging hallmark might NAD 500mg help you model or mitigate? Could it reveal new synergies in your metabolic or neuroprotective protocols?
Share your thoughts in the scientific community—the questions drive innovation.
In conclusion, NAD 500mg from Cali BioLab Peptides is more than a coenzyme—it's a gateway to understanding life's energetic foundations. With unmatched purity, ample quantity, and proven versatility, this vial of NAD 500mg is ready to energize your research endeavors.
Ready to replenish cellular vitality in your models? Order NAD 500mg today at Cali BioLab Peptides and propel your experiments forward with the power of the master coenzyme.
Retatrutide (GLP-3 RT) 10mg – High-Purity Research Peptide
Retatrutide (GLP-3 RT) is a novel research peptide investigated for its potential in weight management, glycaemic regulation, and metabolic health. Classified as a GLP-1/GIP/glucagon triple receptor agonist, it has attracted attention in preclinical studies for its ability to influence appetite suppression, energy balance, and glucose metabolism.
Supplied in lyophilised (freeze-dried) form to preserve stability, this compound is verified at >99.1% purity (HPLC-tested) and provided with full Certificates of Analysis (COAs).
What is Retatrutide (GLP-3 RT)?
Retatrutide is a synthetic peptide designed to act on three key metabolic pathways: GLP-1, GIP, and glucagon receptors. This mechanism is being explored for its potential role in regulating caloric intake, supporting glucose balance, and promoting efficient fat metabolism.
All Bluewell Peptides products are strictly intended for laboratory research use only and are supplied with full COA verification for transparency.
Scientific Identifiers
Product Name: Retatrutide (GLP-3 RT) 10mg
Catalogue Number: BWP-RETA-10
CAS Number: 2381089-83-2
Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈
Molecular Weight: 4731.33 g/mol
Form: Lyophilised Solid
Purity: >99.1% (HPLC Verified)
Storage: Store at −20°C, protected from light
Unit Size: 10mg
Usage and Reconstitution
Retatrutide is supplied as a lyophilised solid for long-term stability. For laboratory use, it may be reconstituted with bacteriostatic water or another suitable solvent according to research protocols. For detailed handling guidance, please refer to our peptide reconstitution page.
Retatrutide has been investigated in preclinical and laboratory studies for its potential influence on:
Weight Management – Explored for roles in appetite suppression, reduced caloric intake, and body fat composition.
Glycaemic Control – Studied for its effects on glucose regulation through incretin pathways.
Metabolic Health – Researched for its potential to enhance energy expenditure and improve metabolic efficiency.
References available on request or through our research archive.
Why Order Retatrutide from Cali BioLab Peptides?
99.1% purity, HPLC-verified
COA provided with every batch
Secure ordering and fast USA delivery
Transparent, research-focused supplier
Excellent customer support and trusted reviews
The Hidden Defender Within: How One Tiny Peptide Is Revolutionizing Lab Studies on Infection, Healing, and Immunity
Picture this: deep inside the human body, a microscopic guardian stands ready to battle invading pathogens, orchestrate wound closure, and even guide new blood vessel formation—all without relying on traditional antibiotics or growth factors. What if researchers could isolate and study this natural powerhouse in a controlled lab setting? Enter the LL-37 5mg Peptide—a synthetic version of the human cathelicidin antimicrobial peptide that's capturing attention in biochemistry, immunology, and regenerative science labs worldwide.
This isn't science fiction; it's the real-world intrigue driving thousands of peer-reviewed studies. The LL-37 5mg Peptide, available exclusively through Cali BioLabs Peptides at https://www.calibiolabpeptides.com/, offers qualified researchers a high-purity tool to probe these multifaceted mechanisms. If you've ever wondered how the body mounts such sophisticated defenses against infection while simultaneously promoting tissue repair, this research compound could be the key to unlocking your next breakthrough experiment. Ready to explore why labs are stocking up on LL-37 5mg Peptide? Let's dive in.
Important Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research applications. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or approved animal model studies. Cali BioLabs Peptides prioritizes full regulatory compliance.
The Story of Dr. Marcus and the Chronic Wound Model That Changed Everything
In a mid-sized biotech lab in Boston, Dr. Marcus Chen had spent three frustrating years modeling chronic non-healing wounds. Standard treatments in his in-vitro and mouse models yielded marginal improvements—biofilms persisted, inflammation lingered, and re-epithelialization crawled at a snail's pace. Funding deadlines loomed, and his grant renewal hung in the balance.
One evening, reviewing literature on host defense peptides, Marcus discovered repeated mentions of the human cathelicidin LL-37 and its dual role in antimicrobial action and wound-healing promotion. Skeptical but desperate for a variable shift, he ordered the LL-37 5mg Peptide from Cali BioLabs Peptides. The vial arrived lyophilized, pristine, with a batch-specific COA showing ≥99% purity confirmed by third-party HPLC/MS.
In his next series of experiments, Marcus applied reconstituted LL-37 5mg Peptide to biofilm-laden keratinocyte cultures and diabetic-mimicking wound models. The results stunned the team: bacterial load dropped dramatically within hours, inflammatory cytokine profiles shifted toward resolution, and scratch assays showed accelerated closure rates—up to 40% faster than controls in some replicates. Angiogenesis markers spiked, with tube formation assays revealing robust endothelial network development.
Marcus's paper, later accepted in a high-impact journal on wound biology, credited the LL-37 5mg Peptide as the pivotal reagent that bridged antimicrobial defense and regenerative signaling. His lab secured renewed funding, and the story spread through research networks. Today, Marcus still keeps a framed photo of that first successful assay plate on his desk—a reminder that sometimes the smallest molecule delivers the biggest shift.
Have you experienced a similar "turning point" reagent in your own research? What compound unexpectedly unlocked progress in your models?
What Exactly Is the LL-37 5mg Peptide?
The LL-37 5mg Peptide is a synthetic recreation of the C-terminal 37-amino-acid fragment of human cathelicidin (hCAP-18/LL-37), one of the few cathelicidins expressed in humans. This amphipathic, α-helical peptide is naturally produced by neutrophils, epithelial cells, keratinocytes, and certain lymphocytes as part of the innate immune response.
In research settings, the LL-37 5mg Peptide arrives as a sterile, white lyophilized powder in 5mg vials—perfect for multiple assays, dose-response curves, or extended protocols without constant reordering. Key specifications include:
Purity: ≥99% (third-party verified via HPLC and Mass Spectrometry)
Form: Lyophilized for stability during shipping and storage
Molecular Weight: ~4.5 kDa
Sequence: [LL-37, 37 aa]
Storage Recommendation: -20°C long-term; 2-8°C after reconstitution with bacteriostatic water or PBS
COA: Batch-specific analytical report included with every order
Unlike many research compounds limited to one function, LL-37 5mg Peptide exhibits remarkable multifunctionality. It directly disrupts microbial membranes via carpet-like or toroidal pore mechanisms, inhibits biofilm formation, modulates immune cell chemotaxis, promotes angiogenesis through pathways like FPRL1/VEGFR2 signaling, and influences wound re-epithelialization by activating EGFR and other receptors.
These properties make the LL-37 5mg Peptide a versatile probe for studying innate immunity, infectious disease models, chronic inflammation, tissue repair, and even autoimmune pathway dysregulation (where dysregulated LL-37 expression has been implicated).
Why Researchers Are Turning to LL-37 5mg Peptide in 2026
The "why" is straightforward yet profound: modern research demands tools that mirror complex biological realities. Antibiotics face rising resistance; chronic wounds affect millions with limited options; and understanding host-pathogen-immune crosstalk requires compounds that act at multiple levels.
The LL-37 5mg Peptide addresses these challenges head-on. In vitro and animal model studies consistently demonstrate its ability to:
Exert broad-spectrum antimicrobial effects against Gram-positive, Gram-negative bacteria, fungi, and certain viruses
Disrupt established biofilms—a major barrier in chronic infection models
Accelerate wound closure by enhancing keratinocyte migration, fibroblast activity, and collagen deposition
Stimulate angiogenesis, improving perfusion in ischemia or diabetic models
Modulate inflammation: pro-inflammatory at high concentrations to recruit immune cells, anti-inflammatory at physiological levels to resolve responses
Influence adaptive immunity by promoting dendritic cell maturation and T-cell responses
Sourcing from Cali BioLabs Peptides adds compelling reasons: USA-based manufacturing in certified facilities, fast domestic shipping (often same/next-day processing), free shipping thresholds, secure checkout, and unwavering research-only compliance. Why risk variable purity or delayed delivery when you can have guaranteed quality?
How to Work with LL-37 5mg Peptide in the Lab
Reconstitution and handling of the LL-37 5mg Peptide are straightforward but require precision to preserve activity.
Preparation: Allow the vial to equilibrate to room temperature to avoid condensation.
Reconstitution: Add 1-2 mL bacteriostatic water, sterile PBS, or culture medium-compatible solvent. Gently swirl—never vortex vigorously to prevent aggregation or loss of helical structure.
Concentration: Common stock solutions range from 1-10 mg/mL; dilute further for working concentrations (typically 0.1-10 μM in cell culture or 1-50 μg/mL in antimicrobial assays).
Storage: Use immediately for short-term experiments or aliquot and freeze at -80°C. Avoid repeated freeze-thaw cycles.
Application Examples:
Antimicrobial assays: Add to bacterial cultures (MIC determination, time-kill curves)
Wound models: Incorporate into scratch assays, 3D skin equivalents, or ex-vivo human skin explants
Angiogenesis: Tube formation on Matrigel with endothelial cells
Immunomodulation: Treat monocyte/macrophage or dendritic cell cultures to assess cytokine profiles
Always use sterile technique, appropriate PPE, and dispose according to lab protocols. Detailed handling guides are available on the product page at calibiolabpeptides.com.
Q: What makes LL-37 different from other antimicrobial peptides? A: Its human origin reduces immunogenicity concerns in models, and its dual antimicrobial/regenerative roles set it apart from purely lytic peptides.
Q: Is LL-37 stable in culture media? A: Moderately—serum can reduce half-life due to proteases, so protease inhibitors or serum-free conditions are often used in long incubations.
Q: Can I use LL-37 5mg Peptide for in vivo animal studies? A: Yes, in approved protocols—common routes include topical, subcutaneous, or intraperitoneal, with doses typically 1-100 μg/kg depending on model.
Q: How does LL-37 compare to synthetic analogs or shorter fragments? A: Full-length LL-37 retains the broadest activity; fragments may offer improved stability or reduced cytotoxicity but lose some multifunctional potency.
Q: What if my vial arrives compromised? A: Contact Cali BioLabs Peptides support immediately—replacements are provided for verified issues.
Q: Is LL-37 suitable for studying autoimmune models? A: Yes—elevated LL-37 is implicated in conditions like psoriasis and lupus, making it valuable for pathway dissection.
What Breakthrough Could LL-37 5mg Peptide Enable in Your Lab Next?
As we close this exploration, consider this: With rising antibiotic resistance, persistent chronic wounds, and the quest for better infection-healing balance, what specific question could the LL-37 5mg Peptide help you answer? Perhaps dissecting biofilm-immune evasion, optimizing angiogenic therapies, or modeling innate-adaptive crosstalk?
Share your research ideas or current challenges—the scientific community thrives on these exchanges.
In summary, the LL-37 5mg Peptide from Cali BioLabs Peptides is more than a research reagent—it's a window into one of nature's most elegant defense systems. High purity, reliable supply, and unmatched multifunctionality make it an essential addition for labs pushing boundaries in 2026.
Order your LL-37 5mg Peptide today at Cali BioLab Peptides and elevate your experiments with confidence.
Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu – The Four-Peptide Powerhouse Engineered for Maximum Tissue Repair & Recovery Research
What if four of the most intensively studied regenerative peptides in modern biochemistry were combined in precise ratios inside one vial, creating a synergistic research tool capable of simultaneously accelerating tendon/ligament healing, suppressing inflammation at multiple checkpoints, promoting angiogenesis, stimulating collagen remodeling, protecting against oxidative damage, and supporting full-spectrum soft-tissue recovery—all in models where single-peptide approaches fall short? That is exactly what labs worldwide are beginning to explore with the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu, the most comprehensive all-in-one regenerative peptide formulation currently available for serious tissue-repair and anti-inflammatory research.
At Cali BioLab Peptides, the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu is supplied as a sterile, high-purity lyophilized powder in an 80mg total vial (typical breakdown: 20mg BPC-157 + 20mg TB-500 + 20mg KPV + 20mg GHK-Cu), third-party HPLC/MS verified, batch-specific COAs included, and shipped fast within the USA. Designed exclusively for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies.
Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research application. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLab Peptides maintains full regulatory compliance.
The Lab That Turned Chronic Tendon Injury Research Upside Down: Dr. Elena’s Achilles Tendinopathy Model
In a tendon and ligament regeneration lab at a leading European sports-medicine university, Dr. Elena Moreau had spent three years perfecting a chronic Achilles tendinopathy model in rats using collagenase injection + mechanical overload. Control animals showed persistent matrix disorganization, low collagen I/III ratio, elevated inflammatory cytokines (TNF-α, IL-1β, IL-6), poor angiogenesis (low VEGF/CD31), minimal tenocyte proliferation, and functional deficits (reduced tensile strength, impaired gait) even 12 weeks post-injury.
Single-peptide protocols (high-dose BPC-157, TB-500 monotherapy, GHK-Cu topical) produced partial improvements but never achieved full structural and functional restoration. Elena hypothesized that simultaneous multi-pathway targeting could break the chronicity cycle. She ordered the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu from Cali BioLab Peptides. The 80mg vial arrived sterile and lyophilized with COA confirming >99% purity across all four components.
In her 8-week protocol, Elena administered subcutaneous Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu (~200–400 μg/kg total daily, divided doses). The results were unprecedented in her lab: treated tendons displayed near-normal collagen alignment (polarized light microscopy), restored I/III ratio, dramatically reduced inflammatory infiltrate (histology & cytokine ELISA), robust neovascularization (CD31/VEGF staining), significantly increased tenocyte density and proliferation (Ki-67), and functional recovery approaching sham levels (tensile testing, gait analysis). Most impressively, the blend outperformed any single-peptide or two-peptide combination she had previously tested.
Elena’s publication in a top regenerative medicine journal described the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu as the first formulation to achieve near-complete resolution of chronic tendinopathy hallmarks in a validated model, opening doors to new grants and industry collaborations focused on multi-target peptide therapeutics. The blend has since become the default starting point for her group’s tendon, ligament, and soft-tissue repair studies.
What Exactly Is the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu?
The Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu is a precisely formulated four-peptide combination designed for researchers who want to study multi-pathway regenerative and anti-inflammatory synergy in a single preparation. Typical breakdown (subject to batch-specific COA):
BPC-157 20mg – Body Protection Compound-157 (pentadecapeptide)
TB-500 20mg – Thymosin Beta-4 fragment (43-amino-acid actin-sequestering peptide)
KPV 20mg – Lys-Pro-Val (C-terminal tripeptide of α-MSH)
When combined in the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu, researchers can study emergent synergistic effects on full-thickness tissue repair that single agents rarely achieve.
Usage and Reconstitution Guidelines
Allow vial to reach room temperature.
Add 2–4 mL bacteriostatic water or sterile PBS; gently swirl (avoid vigorous shaking).
Stock concentration example: 20–40 mg/mL total blend.
Aliquot immediately → store at –80 °C. Thawed aliquots stable 2–8 °C for 7–14 days.
Typical research dosing: 100–500 μg/kg total blend (subcutaneous, intraperitoneal, or localized injection).
Research Applications of Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu
Q: Why combine all four peptides instead of using them separately? A: The Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu allows researchers to study true multi-target synergy on overlapping pathways (angiogenesis, matrix remodeling, inflammation resolution, epithelial protection) in a single preparation—often revealing emergent effects not seen with sequential or individual dosing.
Q: What is the typical dosing ratio in the Klow Blend? A: Standard formulation is 20mg BPC-157 + 20mg TB-500 + 20mg KPV + 20mg GHK-Cu per 80mg vial. Always confirm exact composition via batch COA.
Q: Is the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu stable after reconstitution? A: Yes—stable 7–14 days at 2–8 °C when aliquoted; freeze for longer storage.
Q: Can it be used in chronic inflammation or fibrosis models? A: Yes—preclinical rationale supports investigation in fibrosis, chronic tendinopathy, IBD analogs, and adhesion models.
Q: How to verify batch composition? A: Cross-reference the batch-specific COA provided with your order.
One Question That Could Define Your Next Regenerative Study
If you could target four complementary repair pathways simultaneously in a chronic injury or inflammatory model right now, which tissue—tendon/ligament, skin/mucosa, muscle, or joint—would you prioritize first, and what single endpoint (tensile strength, collagen organization, cytokine suppression, angiogenesis) would you measure to prove synergy?
Your answer might just become the foundation of your next publication.
In summary, the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu from Cali BioLab Peptides is the most comprehensive multi-pathway regenerative research tool currently available. With exceptional purity, balanced formulation, reliable supply, and growing preclinical rationale, it's ready to accelerate your 2026 soft-tissue and inflammation-resolution studies.
Order your Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu today at Cali BioLab Peptides and investigate true regenerative synergy with confidence.
Free home delivery
Provide free home delivery for
all product over $200 and Timely Delivery
Quality Products
We ensure the product quality
that is our main goal
30 Days Return
Return product within 30 days
for any product you buy
Online Support
We ensure the product quality
that you can trust easily